DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crispld1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:250 Identity:56/250 - (22%)
Similarity:75/250 - (30%) Gaps:99/250 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDN 96
            |||.| .||:|                   :.:|.|||..|.:|       .|.|..|..:.||.
  Rat    53 GKRAI-TDNDM-------------------QSILDLHNKLRSQV-------YPAASNMEYMTWDV 90

  Fly    97 YLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQS------NVREMTILAEQ 155
            .|...||...:.|..:....|.:                   |.|.|:      ..|..|...:.
  Rat    91 ELERSAESWAETCLWEHGPTSLL-------------------PSIGQNLGAHWGRYRPPTFHVQA 136

  Fly   156 WLDELYDL--------DDIATYSAEGEI----RNIINDRSSYMGCAA---------GQDYDLWNI 199
            |.||:.|.        |....:...|.:    ..::...||.:|||.         ||   :|..
  Rat   137 WYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAINLCHNMNIWGQ---IWPK 198

  Fly   200 HFVLVCYY------------------SSGPPVEGNLYEEGIFNATLCPNGQSDEY 236
            ...|||.|                  |:.||..|     |.....||....||:|
  Rat   199 AVYLVCNYSPKGNWWGHAPYKHGKPCSACPPSFG-----GGCRENLCYKEGSDQY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 39/191 (20%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 38/172 (22%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.