DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Clec18a

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:247 Identity:46/247 - (18%)
Similarity:82/247 - (33%) Gaps:51/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVAS 77
            :|.|..:|.|.:.:::.....:.:.....:...||.|              :|..||..|.:|. 
  Rat    41 LLLLLPLLGITWTEVQPPQLPKQVPIVQALSRKESFL--------------ILTTHNRLRSQVH- 90

  Fly    78 NLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIR 142
                  |.|..|..:.|...|:.:|:.....|......:......:..:..:|    ....|:..
  Rat    91 ------PSAANMQRMDWSESLAQLAQARAALCGTSATPNLAATLRNTPDVGWN----VQLLPMGS 145

  Fly   143 QSNVREMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFV----- 202
            .|.|..:.:...:.|...:...:.|..:.......::...||.:||.       |...||     
  Rat   146 ASFVEVVNVWFAEGLQYRHGSAECAHNATCAHYTQLVWATSSQLGCG-------WQPCFVDQVAT 203

  Fly   203 --LVCYYSSGP--PVEGNL---YEEGIFNATLCPNGQS------DEYPNLCK 241
              .||.||.|.  .:.|.:   |::|.: .:||....|      |....||:
  Rat   204 EAFVCAYSPGGNWEINGKMIAPYKKGPW-CSLCTASVSGCFKAWDHAGGLCE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 27/153 (18%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 28/165 (17%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.