DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and F09B9.5

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:158 Identity:35/158 - (22%)
Similarity:57/158 - (36%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 MDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQSNVREMTILAEQWLD-----------ELYDLD 164
            |.:|:|.....|.....| |.....:..|.:..|  .|::.:|:||.|           ||..:.
 Worm     1 MTIPEDEKEFVDQMLLEH-NTRRKMHSAPNLECS--EELSEMAQQWADKLAKQAHISFSELSGIG 62

  Fly   165 DIATY-----SAEGEIRNIINDRSSY----MGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLY-- 218
            :..|:     .||..:.:...:...|    .|...|.:|      |..|.:.|:.....|..|  
 Worm    63 ENITFFPPDIDAESVVEHWYQEHEKYEYETPGWQTGTNY------FTQVIWRSTKEIGVGCAYVR 121

  Fly   219 --EEGIFNATLCPNGQSDEYPNLCKTLT 244
              .|...:.|.|.||      ::||::|
 Worm   122 KSHENDEDNTSCSNG------SVCKSMT 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 24/116 (21%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.