DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:228 Identity:57/228 - (25%)
Similarity:83/228 - (36%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SCLRFHGLVNMA------------YFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLS 99
            |||...||..:|            :|.:..:..||.:|.:|.       |||..|..::||..|:
Human    93 SCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVN-------PPAADMKYMIWDKGLA 150

  Fly   100 VVAEYHLKRCQM---DLPDDS--CVATDDFSEPHFNYA---------EDFYPRPVIRQSNVREMT 150
            .:|:....:|:.   |..|.|  |.|.       |.|.         :.|.||..|         
Human   151 KMAKAWANQCKFEHNDCLDKSYKCYAA-------FEYVGENIWLGGIKSFTPRHAI--------- 199

  Fly   151 ILAEQWLDE--LYDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIH-FVLVCYYSSGPP 212
               ..|.:|  .||.|.::.....|....::...|.|:|||.....:|.... .:.||.|  || 
Human   200 ---TAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNY--GP- 258

  Fly   213 VEGNL-----YEEGIFNATLCPNGQSDEYPNLC 240
             .||.     |..| .:.:|| :.:.....|||
Human   259 -AGNFANMPPYVRG-ESCSLC-SKEEKCVKNLC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/163 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.