DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and antr

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:107/260 - (41%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRLQLTLFLCKILFLRSILAID--FCDIKSC-HGKRHIGCDNNMMFDESCLRFHGLVNM-AYFR 61
            |:...|.|||..:  ..|::..|  .|....| :.:.|:||.......|.|.:.:..:|: ...:
  Fly     1 MKMWYLYLFLLPL--TASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALK 63

  Fly    62 EYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSE 126
            ..:|...|..|..|||.: .:...|.:||.:.||..|..:|:..:::|  |.....|..||    
  Fly    64 TGILSRINMLRNYVASGV-GNYSVAARMPTMGWDFELQRLADRQVRQC--DETGKFCANTD---- 121

  Fly   127 PHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELY-----------DLDDIATYSAEGEIRNIIN 180
             .::|......|..:.::...:..|| ::.|.||:           .|..:...:..|....:|.
  Fly   122 -KYHYVATTEIRSKMGRTKSLKSAIL-DKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQ 184

  Fly   181 DRSSYMGC---AAGQDYDLWNIHFVLVCYYSSGPPVEGNL--YEEGIFNATLCPNGQSDEYPNLC 240
            |..|.|||   ..|:|....||  :|:|::|...  ..||  ||||...|..|..|.|..|..||
  Fly   185 DHGSRMGCGLRVKGRDEKESNI--ILLCHFSRAS--VNNLVPYEEGQIPAGKCATGPSQMYQFLC 245

  Fly   241  240
              Fly   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 39/160 (24%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 39/160 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.