DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scl-27

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:214 Identity:48/214 - (22%)
Similarity:80/214 - (37%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AYFREYLLGLHNGYRQEVASNLF---VDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCV 119
            ||.|  ::.:||....:||...:   .|.|.|.:|..:.|:..|:.........||.        
 Worm    23 AYDR--IVKVHNELGNDVACGKYQNHSDYPKASQMMMMKWNQSLAEAVGNVKHSCQQ-------- 77

  Fly   120 ATDDFSEPHFNYAEDFYPRPVIRQSNVREM----TILAEQWLDELYDLDDI-----------ATY 169
                        .::.|.:..|:..|:..:    |:     :|.|.:.|:|           |.:
 Worm    78 ------------LKERYLKKFIKGENLYRVYFYNTV-----VDGLQERDEILRRSEKAVSTGANF 125

  Fly   170 SAEGEIRNIINDR-----SSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVE-GNLYEEGIFNATLC 228
            ..| ....|::|:     .||..|...|.||:    ...:|.||   |:: |::|..| ...:.|
 Worm   126 EVE-RFHKILHDKVTSIGCSYKNCENDQGYDM----RYFICKYS---PIDNGDMYHVG-EPCSQC 181

  Fly   229 PNGQS------DEYPNLCK 241
            |.|.|      .|:.|||:
 Worm   182 PVGTSCNQNANSEFFNLCQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 32/169 (19%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 31/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4141
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_148206
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.