DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scl-10

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_502498.1 Gene:scl-10 / 186049 WormBaseID:WBGene00009891 Length:212 Species:Caenorhabditis elegans


Alignment Length:198 Identity:46/198 - (23%)
Similarity:77/198 - (38%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFV----DLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVAT 121
            :.|:|..||..|.::|...:|    ..|.|..|.:|:||..|...|:           |.|....
 Worm    27 KNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQ-----------DYSTGCP 80

  Fly   122 DDFSEPHFNYAEDFY--PRPVI----------RQSNVREMTILAEQW-----LDELYDLDDIATY 169
            ...|....|..|:.|  ..||:          |.:|:.|.......|     .:||::       
 Worm    81 TGHSASRANIGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFN------- 138

  Fly   170 SAEGEIRNIINDRSSYMGCAAGQ-DYDLWNIHFVLVCYYS-SGPPVEGNLYEEGIFNATLCPNGQ 232
            |..|....:....::.:||...: ..|.:...:|:||.|| :|..:..::|:.| ...:.||:|.
 Worm   139 SGIGHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSG-ETCSNCPDGT 202

  Fly   233 SDE 235
            :.|
 Worm   203 NCE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 37/168 (22%)
scl-10NP_502498.1 SCP 25..179 CDD:214553 38/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.