DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scl-23

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:246 Identity:58/246 - (23%)
Similarity:86/246 - (34%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RFHGLVNM--AYFR--------EYLLGLHNGYRQEVASNLF-VD---LPPAQKMPELVWDNYLSV 100
            ||..:..|  ||.|        ..:|..||..|.:||...: ||   ||||..|.:|.||..|.:
 Worm   101 RFSVITKMAPAYCRLNLPARLQNLILDKHNEIRSQVALGQYAVDDDYLPPADNMVKLDWDCELEL 165

  Fly   101 VAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPV-------------------IRQSNV 146
            .|:...::|.:. .::|....:.:.|.....|  ||.|..                   |..:.:
 Worm   166 EAQQRAQQCNLQ-KENSGRQMNGWDEVRGENA--FYFRTTDGLDVSGAVLKGIQRMGDEIAIAGI 227

  Fly   147 REMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRSSYMGCAA------------GQDYDLWNI 199
            :.:.:       ..||       |..|....|:...:..:|||.            ||.|:    
 Worm   228 KNLKL-------SRYD-------SRIGHATQILWKETRKLGCAVQECPARQDGSLDGQKYN---- 274

  Fly   200 HFVLVC-YYSSGPPVEG----NLYEEGIFNATLCPNGQ-SDEYPNLCKTLT 244
              |.|| ||.:|...:.    ::|..|.. |:.|..|. .|....||...|
 Worm   275 --VAVCKYYPTGNVFKSSTPTSIYSVGDV-ASACSEGTFGDPSTGLCVAAT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 42/190 (22%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.