DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and vap-1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:242 Identity:53/242 - (21%)
Similarity:85/242 - (35%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GCDNNMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVD----LPPAQKMPELVWDNY 97
            ||.|..:.|::             |:.....||..|:.:|..|..:    |...:.:.||.||  
 Worm    22 GCSNTKINDQA-------------RKMFYDAHNDARRSMAKGLEPNKCGLLSGGKNVYELNWD-- 71

  Fly    98 LSVVAEYHLKRCQMDLP----DDSCVATDDFSEPHF--NYAEDFYPRPVIRQSNVREMTILAEQW 156
                       |:|:..    .|.|.::....:|.:  |||.  |...:........|.:  ..|
 Worm    72 -----------CEMEAKAQEWADGCPSSFQTFDPTWGQNYAT--YMGSIADPLPYASMAV--NGW 121

  Fly   157 LDE-----LYDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLVCYYSS-GPPVEG 215
            ..|     |.|.|:..|.||.....|:.|.::|..|||    |.|......:.|.|:. |.....
 Worm   122 WSEIRTVGLTDPDNKYTNSAMFRFANMANGKASAFGCA----YALCAGKLSINCIYNKIGYMTNA 182

  Fly   216 NLYEEG----------IFNATLCPNGQSDEYP--------NLCKTLT 244
            .:||:|          .::.:.|.||...:.|        .:|.::|
 Worm   183 IIYEKGDACTSDAECTTYSDSQCKNGLCYKAPQAPVVETFTMCPSVT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/161 (24%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553 39/177 (22%)
SCP 234..386 CDD:214553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.