DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and scl-5

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:195 Identity:41/195 - (21%)
Similarity:73/195 - (37%) Gaps:43/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLGLHNGYRQEVASNLFV----DLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF 124
            :|.:||..|..:|...:|    ..|.|..|.::.||..::..|:.:..:|    |.....|.   
 Worm    27 ILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKC----PTGHSGAA--- 84

  Fly   125 SEPHFNYAEDFY---PRPVIRQSNVREMTIL-AEQWLDELYDLDDIATYSAEGEIRNIIND---- 181
                 ...|:.|   ....|  :|:.:.... :..|..|..|..    :|:.....::.|.    
 Worm    85 -----GLGENLYWYWTSATI--TNIDQFGATGSAAWEKEFQDYG----WSSNTLSMSLFNTGIGH 138

  Fly   182 -------RSSYMGCA---AGQDYDLWNIHFVLVCYYS-SGPPVEGNLYEEGIFNATLCPNGQSDE 235
                   :::.:||.   .|:|.:.:| ...:||.|. .|..:..|:|..|. ..:.||:|.|.|
 Worm   139 ATQMAWAKTNLIGCGVKNCGKDTNGFN-KVTVVCQYKPQGNYLNQNIYTSGT-TCSKCPSGTSCE 201

  Fly   236  235
             Worm   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 31/165 (19%)
scl-5NP_502506.1 SCP 22..175 CDD:214553 32/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.