DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crispld2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:276 Identity:58/276 - (21%)
Similarity:87/276 - (31%) Gaps:95/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFLCKI--LFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLH 68
            |.|.:|.:  .||.:.::::....|..|.:.|             .|....:.|: .|:.:|.||
  Rat    13 LALLVCGVQAFFLPNTMSLERLLSKYQHTEPH-------------SRVRRAIPMS-DRQEILMLH 63

  Fly    69 NGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRC---------QMDLPDDSCVATDDF 124
            |..|.:|       .|||..|..:.||..|...|....:||         .:.:..:..|....:
  Rat    64 NKLRGQV-------YPPASNMEYMTWDEELERSAAAWAQRCLWEHGPASLLVSIGQNLAVHWGRY 121

  Fly   125 SEPHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAEGEIRNIINDRSS----- 184
            ..|.|:                      .:.|.||:.|.    ||....|......:|.|     
  Rat   122 RSPGFH----------------------VQSWYDEVKDY----TYPYPHECNPWCPERCSGAMCT 160

  Fly   185 -----------YMGCAA---------GQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFN----A 225
                       .:|||.         |   |:|.....|||.||.    :||...|..:.    .
  Rat   161 HYTQMVWATTNKIGCAVHTCRSMSVWG---DIWENAVYLVCNYSP----KGNWIGEAPYKHGRPC 218

  Fly   226 TLCPNGQSDE-YPNLC 240
            :.||:..... ..|||
  Rat   219 SECPSSYGGGCRNNLC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/180 (21%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 38/180 (21%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.