DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CRISP1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:212 Identity:47/212 - (22%)
Similarity:76/212 - (35%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RFHGLV-NMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMD- 112
            :|:.|| ::...:|.::.:||..|:.|       :|||..|.::.|....:..|....|.|.|. 
Human    29 QFNKLVTDLPNVQEEIVNIHNALRRRV-------VPPASNMLKMSWSEEAAQNARIFSKYCDMTE 86

  Fly   113 -------LPDDSCVATDDFSEPHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDL------- 163
                   ||:..|..         |.....||   :..|:|..:      |..|....       
Human    87 SNPLERRLPNTFCGE---------NMHMTSYP---VSWSSVIGV------WYSESTSFKHGEWTT 133

  Fly   164 --DDIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLVCYY---SSGPPVEGNLYEEGIF 223
              |||.|    .....|:...|..:|||........:..::.||:|   .:.|..:...|:.|: 
Human   134 TDDDITT----DHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGV- 193

  Fly   224 NATLCPNGQSDEYPNLC 240
            ....||:...|:   ||
Human   194 PCEACPSNCEDK---LC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 36/166 (22%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 36/166 (22%)
Crisp 195..249 CDD:285731 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.