DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and GLIPR2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:190 Identity:35/190 - (18%)
Similarity:62/190 - (32%) Gaps:67/190 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDF 124
            |...:|..||.|||:..      :||                    ||.|:            :.
Human    24 FHNEVLKAHNEYRQKHG------VPP--------------------LKLCK------------NL 50

  Fly   125 SEPHFNYAEDFYPRPVIRQS----------NVREMTI------LAEQWLDEL--YDLDDIATYSA 171
            :.....|:|......:::.|          |:...:.      :|::|..|:  |:.......|.
Human    51 NREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSG 115

  Fly   172 EGEIRNII--NDRSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCP 229
            .|....::  |.:...:|.|:..|    ...||:..|:.:     ||:..||.|...:.|
Human   116 TGHFTAMVWKNTKKMGVGKASASD----GSSFVVARYFPA-----GNVVNEGFFEENVLP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 28/166 (17%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 30/176 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.