DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CG43777

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:108/266 - (40%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFLCKILFLRSILAIDFCDIKS--C--HGKRHIGCD-NNMMFDESCLRFHGLV-NMAYFREYLLG 66
            |.|..:|.|......::|:.|:  |  ..|:|..|. .:.....:..:||..| |....::..|.
  Fly     5 LLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMRMQKIALD 69

  Fly    67 LHNGYRQEVA--------SNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDD 123
            :.|..|.:.|        :..|.   .|::|.:|.||..|:.:...|..  .:.|....|.:|..
  Fly    70 ILNNLRNKFAGGELRTKGNKTFA---KARRMRQLFWDKELAYMGNNHAS--TLSLKSSQCRSTLR 129

  Fly   124 FSEPHFNYAEDFY-PRPVIRQSNVREM------TILAE-QWLDE----LYDLDDIATYSAEGEIR 176
            |  ||...|.... ||   .:.|::|:      .:.|| |.:.:    |:..|....:... ...
  Fly   130 F--PHVGEAIALVTPR---EKLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVR-HFT 188

  Fly   177 NIINDRSSYMGC--AAGQDYD--LWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPNG--QSDE 235
            |||:||.|.:||  |.|.:.:  :...|| |.||:.........:|:.|...::....|  .||:
  Fly   189 NIISDRVSRVGCGVAVGANCNPSIKFCHF-LTCYFDFHNMAGSYVYKAGDPTSSCDDWGVVSSDK 252

  Fly   236 YPNLCK 241
            |.||||
  Fly   253 YANLCK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 43/170 (25%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 43/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.