DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and Crisp3

DIOPT Version :10

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:49 Identity:10/49 - (20%)
Similarity:21/49 - (42%) Gaps:7/49 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRC 109
            :|.::..||..|::|:       |....:..:.|:....|.|:....:|
Mouse    39 QEEIVSKHNQLRRKVS-------PSGSDLLNMEWNYDAQVNAQQRADKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 CAP_euk 61..208 CDD:349399 10/49 (20%)
Crisp3NP_033769.1 CAP 37..172 CDD:412178 10/49 (20%)
Crisp 194..241 CDD:462519
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.