DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and GLIPR1

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:217 Identity:51/217 - (23%)
Similarity:79/217 - (36%) Gaps:57/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NMMFDESCLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYH 105
            |..|.:.|:|                :||.:|.||.       |.|..|..:.||..|:.:|:..
Human    30 NEDFIKDCVR----------------IHNKFRSEVK-------PTASDMLYMTWDPALAQIAKAW 71

  Fly   106 LKRCQMDLPDDSCVATDDFSEPHF-NYAEDFYPR--PVIRQSNVREMTILAEQWLDELYDLDDIA 167
            ...||..  .::.:.......|:| :..|:.:..  |:...|:.      ...|.||:.|.|...
Human    72 ASNCQFS--HNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSA------ITNWYDEIQDYDFKT 128

  Fly   168 TYSAE--GEIRNIINDRSSYMGCA-------AGQDYDLWNIHFVLVCYYSSGPPVEGNL----YE 219
            ....:  |....::...|..:|||       :|.|......||  :|.|..|    ||.    |:
Human   129 RICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHF--ICNYGPG----GNYPTWPYK 187

  Fly   220 EGIFNATLCPNGQSDE-YPNLC 240
            .|. ..:.|||  :|: ..|||
Human   188 RGA-TCSACPN--NDKCLDNLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 34/158 (22%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 38/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.