DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and CRISP3

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:232 Identity:49/232 - (21%)
Similarity:74/232 - (31%) Gaps:82/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSC 118
            |......:..::..||..|:.|:       |||:.|.::.|:...:..|:....:|         
Human    63 LTTQTQVQREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQC--------- 111

  Fly   119 VATDDFSEPHFNYAEDFYPRPVIRQSNVRE-MTIL------------------AEQWLDELYDLD 164
                       ||          |.||.:: ||.|                  .:.|.||..|.|
Human   112 -----------NY----------RHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFD 155

  Fly   165 ----DIATYSAEGEIRNIINDRSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNL-------Y 218
                .....:..|....::...|..:||......:...:.:..||.|...    ||.       |
Human   156 FGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPA----GNWANRLYVPY 216

  Fly   219 EEGIFNAT--------LCPNG--QSDEYPNLCKTLTL 245
            |:|...|:        ||.||  ..|.|.| ||:|.|
Human   217 EQGAPCASCPDNCDDGLCTNGCKYEDLYSN-CKSLKL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 30/169 (18%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.