DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and pi16

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_031751055.1 Gene:pi16 / 101731805 XenbaseID:XB-GENE-22068880 Length:548 Species:Xenopus tropicalis


Alignment Length:211 Identity:48/211 - (22%)
Similarity:79/211 - (37%) Gaps:71/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFS 125
            :..:|..||.||.:..       |.|..|.:|.||:.|..:|:.:.::|..:...|         
 Frog    30 KRIILDKHNFYRSQTE-------PSASDMIKLTWDSALEAMAKSYAEKCIWEHNKD--------- 78

  Fly   126 EPHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLDD---------IATYSAE-----GEIR 176
                        |..|.::    :.:::...||....|||         ..|...:     |...
 Frog    79 ------------RGFIGEN----LFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYT 127

  Fly   177 NIINDRSSYMGCAAGQDY-------DLWNIHFVLVCYYSSGPPVEGNL-----YEEGIFNATLCP 229
            .::...:..:||  ||::       |..|: ::|||.|.  ||  ||.     |:|| ...|.||
 Frog   128 QMVWAGTERVGC--GQNFCPKLEGVDDENM-YLLVCNYE--PP--GNFEGESPYKEG-SRCTECP 184

  Fly   230 NGQSDE--YPNLCKTL 243
               ||.  ..:||:.:
 Frog   185 ---SDHVCIGSLCENM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 33/167 (20%)
pi16XP_031751055.1 CAP_PI16_HrTT-1 30..163 CDD:349405 33/167 (20%)
PHA03247 <200..414 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.