DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and crisp1.11

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:219 Identity:42/219 - (19%)
Similarity:69/219 - (31%) Gaps:69/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 REYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRC--QMDLPDDSCVATDD 123
            |:.::..||.||:..:       |.|:.|.::||:...:..|......|  ....||...:    
 Frog    60 RQIIIDTHNAYRRNAS-------PSARNMLKMVWNEDAANNAASWSAGCTGSHSPPDKRTI---- 113

  Fly   124 FSEPHFNYAEDFY--PRPVIRQSNVREMTILAEQWLDE----LYDLDDIATYSAEGEIRNIINDR 182
               |.|:..|:.:  ..|...:..|:       .|.||    .|.:...:.....|....::...
 Frog   114 ---PGFSCGENLFLASYPASWEEAVK-------AWFDENESFEYGVGPKSPDQVVGHYTQVMWYN 168

  Fly   183 SSYMGCAAG----QDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNA-----------------T 226
            |..:||:..    ..|     .:..||.|...    ||:  ||:.|.                 :
 Frog   169 SYMVGCSVSYCPKSQY-----KYFYVCQYCPA----GNI--EGVMNTPYKAGPKCADCVEACDNS 222

  Fly   227 LCPN--------GQSDEYPNLCKT 242
            ||.|        .....|.:.|.|
 Frog   223 LCTNYCPYQDTYSSCSNYTSYCNT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 30/158 (19%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 31/160 (19%)
Crisp 212..263 CDD:400739 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.