Sequence 1: | NP_648384.1 | Gene: | CG8072 / 39181 | FlyBaseID: | FBgn0036070 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002937123.2 | Gene: | crispld1 / 100490431 | XenbaseID: | XB-GENE-989389 | Length: | 514 | Species: | Xenopus tropicalis |
Alignment Length: | 214 | Identity: | 55/214 - (25%) |
---|---|---|---|
Similarity: | 72/214 - (33%) | Gaps: | 75/214 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDL-PDDSCVATDDFSEP 127
Fly 128 HFNYAEDFYPRPVIRQS------NVREMTILAEQWLDELYD--------LDDIATYSAEGEI--- 175
Fly 176 -RNIINDRSSYMGCAA---------GQDYDLWNIHFVLVCYYSSGPPVEGNL-----YEEGIFNA 225
Fly 226 TLCP----NGQSDEYPNLC 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8072 | NP_648384.1 | SCP_euk | 61..208 | CDD:240180 | 42/171 (25%) |
crispld1 | XP_002937123.2 | CAP_CRISPLD1 | 62..207 | CDD:349407 | 42/171 (25%) |
LCCL | 304..388 | CDD:128866 | |||
LCCL | 407..506 | CDD:367672 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |