DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and LOC100490275

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:209 Identity:48/209 - (22%)
Similarity:70/209 - (33%) Gaps:77/209 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPH 128
            |:..||..|.|....       |..|..:.||..|:.:|:.....|: .:|:           ||
 Frog    33 LVNAHNDIRNEFGKQ-------AANMLHMSWDVGLAKLAQAWTINCK-KVPN-----------PH 78

  Fly   129 FNYAEDFYPRPVIRQSNVREMTILAEQWLDELY-----DLDDIAT-YSAEGEIRNIIND------ 181
            .| .|..|||              .:|..:.||     |:..|.| :..||...::.|:      
 Frog    79 LN-KESIYPR--------------FKQIGENLYMGPSIDIFKIVTNWGLEGNFYDLKNNSCQPGK 128

  Fly   182 ----------RSSY-MGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIF------------ 223
                      .::| :||.|.  |....:.:|:.|.|  ||  .|||..:..|            
 Frog   129 DCSHFTQIVWANTYKVGCGAA--YCAHKVAYVVSCTY--GP--RGNLLGQVPFILGVKCSKCGGE 187

  Fly   224 --NATLCPNGQSDE 235
              |...|.|...||
 Frog   188 KCNVASCGNPSRDE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 36/166 (22%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.