DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and crispld1a

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:207 Identity:48/207 - (23%)
Similarity:71/207 - (34%) Gaps:64/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPH 128
            :|.|||..|.:|       .|||..|..:||||.|...||...:.|..:......:         
Zfish    70 ILDLHNKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLL--------- 118

  Fly   129 FNYAEDFYPRPVIRQS------NVREMTILAEQWLDELYD--------LDDIATYSAEGEI---- 175
                      |.|.|:      ..|..|...:.|.||:.|        .:....:...|.:    
Zfish   119 ----------PQIGQNLGVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHY 173

  Fly   176 RNIINDRSSYMGCAAGQDYD------LWNIHFVLVCYYSSGPPVEGNL-----YEEGIFNATLCP 229
            ..::...||.:|||....|:      :|.....|||.||.    :||.     |:.|. :.:.||
Zfish   174 TQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSP----KGNWWGYAPYKHGT-SCSACP 233

  Fly   230 NGQSDEYPNLCK 241
                ..|..:|:
Zfish   234 ----PSYGGVCR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/167 (23%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 38/167 (23%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.