Sequence 1: | NP_648384.1 | Gene: | CG8072 / 39181 | FlyBaseID: | FBgn0036070 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001920421.2 | Gene: | crispld1a / 100149104 | ZFINID: | ZDB-GENE-090612-1 | Length: | 508 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 71/207 - (34%) | Gaps: | 64/207 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPH 128
Fly 129 FNYAEDFYPRPVIRQS------NVREMTILAEQWLDELYD--------LDDIATYSAEGEI---- 175
Fly 176 RNIINDRSSYMGCAAGQDYD------LWNIHFVLVCYYSSGPPVEGNL-----YEEGIFNATLCP 229
Fly 230 NGQSDEYPNLCK 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8072 | NP_648384.1 | SCP_euk | 61..208 | CDD:240180 | 38/167 (23%) |
crispld1a | XP_001920421.2 | SCP_euk | 68..212 | CDD:240180 | 38/167 (23%) |
LCCL | 298..381 | CDD:128866 | |||
LCCL | 401..500 | CDD:281766 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170585683 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |