DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8072 and glipr2

DIOPT Version :9

Sequence 1:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001107504.1 Gene:glipr2 / 100135358 XenbaseID:XB-GENE-5758336 Length:441 Species:Xenopus tropicalis


Alignment Length:178 Identity:44/178 - (24%)
Similarity:66/178 - (37%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FREYLLGLHNGYRQ---EVASNLFVDL-PPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVA 120
            ||:.||..||.||:   ..|..|.|.| ..|||     |.::|  |.:..|:.            
 Frog   296 FRKDLLSEHNQYRKLHGAGALQLSVALSQDAQK-----WADHL--VGKPALQN------------ 341

  Fly   121 TDDFSEPHFNYAEDFYPRPVIRQSNVREMT--ILAEQWLDE--LYDLDDIATYSAEGEIRNIIND 181
                |:.|  :.|:.:.|   .::|....|  .:||.|.:|  .|........|..|....:|..
 Frog   342 ----SDTH--HGENLWYR---WETNTSLPTGKEVAESWYNENAKYSFATPGFQSGSGNFTQMIWK 397

  Fly   182 RSSYMGCAAGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCP 229
            .||.:|.....|.   ...::.|.:|...    ||:..:|.|...:.|
 Frog   398 SSSQVGFGLSTDN---KGMYIAVGFYDPA----GNIANKGYFEDNVLP 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 37/154 (24%)
glipr2NP_001107504.1 SCP <3..69 CDD:294090
SCP_GAPR-1_like 118..249 CDD:240182
SCP_GAPR-1_like 295..426 CDD:240182 40/164 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.