DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr21

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:298 Identity:107/298 - (35%)
Similarity:163/298 - (54%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            ||||.:..:|:|||||.:.:|.||:|:||||||:||||||||:|||...|||:||||.:.|::..
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            .:|:||||:.|.||:|:||||:||.|...|::..::|:                           
  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE--------------------------- 153

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
                               |..:|||||::|:|.|||:||||:||..|:||..:.|.|.::.::.
  Fly   154 -------------------PITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINY 199

  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAP 312
            ::..|.:...|.|.:.|.|.|||..|.:..||:|:|.|||....|:.||:|:|:.|.|:|.:   
  Fly   200 DSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKS--- 261

  Fly   313 AAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSL 350
                               .::.:.:.:|..|:.|.:|
  Fly   262 -------------------HLLVSELLSLCFLQICLNL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 49/79 (62%)
IG_like 210..297 CDD:214653 35/86 (41%)
IGc2 217..287 CDD:197706 28/69 (41%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 46/77 (60%)
IG_like 71..140 CDD:214653 43/68 (63%)
IG_like 162..249 CDD:214653 35/86 (41%)
IGc2 169..242 CDD:197706 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444676
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D77526at33392
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.