DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and KIRREL3

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:317 Identity:72/317 - (22%)
Similarity:116/317 - (36%) Gaps:86/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL 122
            |.|:::...:|..|...|......:.|:.|::.....:|:                    :|.||
Human   345 TEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLS--------------------NEKTL 389

  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187
            .:|..:|.|||.|.|:.             :|..:.|                 .|..|..:.| 
Human   390 TLKSVRQEDAGKYVCRA-------------VVPRVGA-----------------GEREVTLTVN- 423

  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252
                  ||....:..|...|.|     :||   .:.|.|:.:| ||..|.|..::.||...|| |
Human   424 ------GPPIISSTQTQHALHG-----EKG---QIKCFIRSTP-PPDRIAWSWKENVLESGTS-G 472

  Fly   253 RLKFKTIKSEE----TKSILLIYDADLLHSGKYSC-----YPSNTEIASIRVHVLQGERPEAMQT 308
            |...:||.:||    |.:|..|..||.  ...|:|     :.|:|||..::....:.:....::.
Human   473 RYTVETISTEEGVISTLTISNIVRADF--QTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEA 535

  Fly   309 NAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGS 365
            .:.|.||.:       |.|..|......::|.:|.. .|:.....:||..|..|.|:
Human   536 ESVPMAVII-------GVAVGAGVAFLVLMATIVAF-CCARSQRSTGGRSGISGRGT 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 16/79 (20%)
IG_like 210..297 CDD:214653 30/95 (32%)
IGc2 217..287 CDD:197706 25/78 (32%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606
I-set 341..422 CDD:254352 22/126 (17%)
IGc2 355..406 CDD:197706 16/70 (23%)
Ig5_KIRREL3 424..521 CDD:143306 35/108 (32%)
IG_like 432..521 CDD:214653 33/100 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.