DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:285 Identity:73/285 - (25%)
Similarity:102/285 - (35%) Gaps:75/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGC 75
            ||...:|.....:.|..|..|......:...|..|.       :.|:.  .|||...|::..|.|
  Fly    18 CLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPE-------FTDVI--ENITVPAGRNVKLAC 73

  Fly    76 RVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSY-----HRDIDEWTLQIKWAQQRDAGVY 135
            .||:||:..|||:......||||..:..|.:.|...::     ||   .|.|.|...|:.|.|.|
  Fly    74 SVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHR---TWFLHINNVQEEDRGRY 135

  Fly   136 ECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVA 200
            .|||:|               :.|:|                              .:|.::.|.
  Fly   136 MCQINT---------------VTAKT------------------------------QYGFVKVVV 155

  Fly   201 VPTA-TILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD--KVLSEETSGGRLKFKTIKSE 262
            .|.. ..|...|:.|.:|..:.|.|..|.||||.  |.|...|  |::..:|       ..:...
  Fly   156 PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIVINKT-------LEVHDL 211

  Fly   263 ETKSILLIYDADLLHSGKYSCYPSN 287
            ||.| |.:.....||.|.|.|..||
  Fly   212 ETDS-LELERISRLHMGAYLCIASN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 31/84 (37%)
IG_like 210..297 CDD:214653 26/80 (33%)
IGc2 217..287 CDD:197706 22/71 (31%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 35/143 (24%)
Ig 69..139 CDD:143165 25/72 (35%)
IG_like 165..249 CDD:214653 26/81 (32%)
IGc2 172..237 CDD:197706 24/74 (32%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.