DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-delta

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:401 Identity:101/401 - (25%)
Similarity:144/401 - (35%) Gaps:123/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHR 115
            :||.|...:| |:|..||:.|.|.|.|:|||...||||......|||:..:..:...|:..:|  
  Fly    42 DEPRFAQPIP-NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITY-- 103

  Fly   116 DIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIA 177
            ..:.|.|.:..|.|.|.|.|.||::|.|:.|....|.:|   :::|.|::               
  Fly   104 TDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIEST--------------- 153

  Fly   178 ENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD 242
                                    |::       :.|.:...||:||.....|.|  .|.|..:|
  Fly   154 ------------------------PSS-------VAVRENQNINMTCRADGFPAP--KIIWRRED 185

  Fly   243 KVLSEETSGGRLKFKTIKSEETKSILLIYDADLL--------HSGKYSCYPSNTEIASIRVHVLQ 299
               .||.           :.|.|..:|:||||:|        ..|.|.|..:|....|:...::.
  Fly   186 ---GEEI-----------AVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL 236

  Fly   300 GERPEAM-----QTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVL-------------LEA 346
            ......|     |...||:...:.. .||.....:|: :.....:.:||             ..|
  Fly   237 DVEFSPMIWVPNQLVGAPSGTDVTI-DCHTEAHPKAI-IYWVYNSVMVLPSKKYKTDYTENSYRA 299

  Fly   347 CSSLL---LQSGGGGG--CPGG---GSPAGGMPTRVREIREKPLTNSLLDPKIPS-----TTSAE 398
            ...|.   ||.|..|.  |...   |...|.:  ||.||   ||      |..||     ||...
  Fly   300 HMKLTIRNLQYGDFGNYRCISKNSLGETEGSI--RVYEI---PL------PSTPSKQVTHTTVES 353

  Fly   399 RVNN---GSRN 406
            |.||   .|||
  Fly   354 RENNIIPSSRN 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 29/79 (37%)
IG_like 210..297 CDD:214653 25/94 (27%)
IGc2 217..287 CDD:197706 22/77 (29%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 34/94 (36%)
Ig 145..238 CDD:416386 28/154 (18%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/11 (9%)
Ig strand B 165..172 CDD:409353 4/6 (67%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/4 (25%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 18/94 (19%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/7 (29%)
Ig strand C 272..277 CDD:409353 0/5 (0%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 2/7 (29%)
Ig strand G 325..334 CDD:409353 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.