DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and CG34353

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:468 Identity:96/468 - (20%)
Similarity:159/468 - (33%) Gaps:142/468 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCYQRQSVSNNNHNN------AEAKPTHAPPSH--------YPH--------------------G 47
            :.|:.:..||:..|:      |||: |.:.|.|        .||                    .
  Fly    17 IAYKFECHSNSKQNSKTGKMAAEAR-TISKPGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSM 80

  Fly    48 HKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTS 112
            ...|||.| ::.......:.|::..|.|.|.:.....|||  .|.:.|||.|:...|.|.|.   
  Fly    81 MTKNEPMF-ISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRV--- 139

  Fly   113 YHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV----------------------- 154
              |.::.:.|||:.|...|||.|.|||:|...|..:..:.|:                       
  Fly   140 --RLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVR 202

  Fly   155 --------------------------DLIDAETSDIMQQYYNDDAFYI--AENRVYQSSNDEFA- 190
                                      :.:.:....|.....:....||  |.|||.|.::.:.. 
  Fly   203 IECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVL 267

  Fly   191 -GMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRL 254
             .:|.|  .::|....:..|      :|....|.||:....:|  .:.|: :|.:..:.|.  |.
  Fly   268 HVLFSP--EISVERPVVFSG------EGHEATLVCIVHGETQP--EVIWF-KDTMQLDTTE--RH 319

  Fly   255 KFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAA----- 314
            ..:|..|..|..|..::..|.   |.|||...| ::...|..:....:|.....|:.|.:     
  Fly   320 IMETRGSRHTLIIRKVHPQDF---GNYSCVAEN-QLGKARKTLQLSGKPNVAVFNSPPISQYKDR 380

  Fly   315 --VALAC--------WSCHFGQATQAVRVISTMV---AALVLLEACSSLLLQSG----------G 356
              ::.|.        :...|.:..|...|:...:   ::...:.:.||.:..||          |
  Fly   381 YNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMG 445

  Fly   357 G-GGCPGGGSPAG 368
            | .|..|.||.:|
  Fly   446 GLSGLSGSGSYSG 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 28/79 (35%)
IG_like 210..297 CDD:214653 20/86 (23%)
IGc2 217..287 CDD:197706 18/69 (26%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 30/86 (35%)
Ig 103..177 CDD:143165 28/80 (35%)
IG_like 191..269 CDD:214653 8/77 (10%)
IGc2 198..258 CDD:197706 6/59 (10%)
I-set 273..360 CDD:254352 23/103 (22%)
Ig 290..359 CDD:143165 19/77 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.