DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and igsf9bb

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio


Alignment Length:293 Identity:64/293 - (21%)
Similarity:101/293 - (34%) Gaps:96/293 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGN---KTVAWIRHRDLHI---LTVGTYTYT 104
            ||.: .||.|       :||..|::..|||.|.|..|   ..|.|.:. .:.|   :....|...
Zfish    24 HGVR-EEPQF-------VTSRAGETVILGCDVVHPLNGQPYVVEWFKF-GVPIPFFINFRFYPPH 79

  Fly   105 TDQRF--QTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQ 167
            .|..:  :.|.|   .:.:|:|:..:..|.|.|||::..                      :.||
Zfish    80 VDPEYAGRASLH---GKSSLRIERVRSEDQGWYECKVLM----------------------LEQQ 119

  Fly   168 Y---YNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVD--KGSTINLTCIIK 227
            |   :|....::..|                    |.||.|  ..|..||:  :|.:|.|:|...
Zfish   120 YHTFHNGSWVHLTVN--------------------APPTFT--DTPPQYVEAKEGGSITLSCTAF 162

  Fly   228 FSPEPPTHIFWYHQDKVLSEET----SGGRLKFKTIKSEETKSILLIYDADLLHSGKYSC--YPS 286
            .:|:|  .:.|..:...:.:.|    |.|.|...:|..|:              .|.|:|  |..
Zfish   163 GNPKP--SVSWLREGNPVQDSTKYKVSDGSLTLVSISRED--------------RGAYTCRAYSE 211

  Fly   287 NTEIASIRVHVLQG-----ERPEAMQTNAAPAA 314
            ..|.......::||     ..||.:..|.:..|
Zfish   212 QGEAVHTTRLLVQGPPFIVSPPENITVNISQDA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/87 (26%)
IG_like 210..297 CDD:214653 21/94 (22%)
IGc2 217..287 CDD:197706 17/75 (23%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653 25/93 (27%)
Ig 41..113 CDD:143165 20/75 (27%)
IG_like 144..223 CDD:214653 20/94 (21%)
IGc2 151..208 CDD:197706 16/72 (22%)
I-set 227..319 CDD:254352 4/18 (22%)
Ig <263..319 CDD:299845
Ig_2 326..414 CDD:290606
IG_like 329..403 CDD:214653
IG_like 424..504 CDD:214653
Ig 440..504 CDD:299845
FN3 509..604 CDD:238020
FN3 620..704 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.