DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and aebp1b

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:166 Identity:32/166 - (19%)
Similarity:59/166 - (35%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TALFCCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSL---- 66
            |.:..||:.|...::...::  .|:.:|.            .|...|.:.:   .||:||:    
Zfish     9 TLVVLCLSLLVPSWEVNGLT--EHSKSEI------------SHTDREQHVE---DRNVTSVEDLL 56

  Fly    67 ------------VGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDE 119
                        ||:...|.|:|.. ..|.:.|:...       |....|.....:...|..:..
Zfish    57 QVKIIPPYATIEVGQHKQLLCKVSS-DAKNINWVSPN-------GEKVLTKHGNLKVHNHGSVLS 113

  Fly   120 WTLQIKWAQQRDAGVYECQISTQPVRSY-SVNLNIV 154
             :|.:..|...:||:|:|..:.....|. :|.|:|:
Zfish   114 -SLTVLNANLNNAGIYKCVATNGDTESQATVKLDII 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/95 (19%)
IG_like 210..297 CDD:214653
IGc2 217..287 CDD:197706
aebp1bXP_696022.6 Ig 56..147 CDD:299845 19/99 (19%)
IG_like 62..145 CDD:214653 18/91 (20%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.