DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and igsf9ba

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:272 Identity:66/272 - (24%)
Similarity:99/272 - (36%) Gaps:95/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKH--LGNKT---VAWIRHRDLHI---LTVGTYT 102
            ||.: .||.|       :|:..|:|..|||.|.|  .|.:|   |.|.:. .:.|   :....|.
Zfish    24 HGVR-EEPQF-------VTARAGESVVLGCDVSHPLNGQQTPYVVEWFKF-GVPIPFFINFRFYP 79

  Fly   103 YTTDQRF--QTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIM 165
            ...|..:  :.|.|   .:.:|||:..:..|.|.|||::.                       ::
Zfish    80 PHVDPEYAGRASLH---GKASLQIEQVRSEDQGWYECRVL-----------------------ML 118

  Fly   166 QQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVD--KGSTINLTCIIKF 228
            :|.|  |.|:          |..:..:     ||..| .|....|..||:  :|.:|.|||....
Zfish   119 EQQY--DTFH----------NGSWVHL-----TVNAP-PTFSDTPPQYVEAREGGSITLTCTAFG 165

  Fly   229 SPEPPTHIFWYHQ-DKVLSEE---TSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTE 289
            :|:|.  :.|..: |::.|..   .|.|.|..:.|..|:              .|.|||      
Zfish   166 NPKPV--VTWLREGDQLTSTRKYTVSDGSLTVQAITRED--------------RGAYSC------ 208

  Fly   290 IASIRVHVLQGE 301
                |.|..|||
Zfish   209 ----RAHSDQGE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 25/89 (28%)
IG_like 210..297 CDD:214653 23/92 (25%)
IGc2 217..287 CDD:197706 19/73 (26%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 27/95 (28%)
I-set 139..225 CDD:254352 28/104 (27%)
I-set 229..321 CDD:333254
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.