DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and robo4

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:452 Identity:86/452 - (19%)
Similarity:143/452 - (31%) Gaps:136/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWTALFC-CLTGL--AVCYQRQSVSNNNHNNAEAKP--THAPPSHYPHGH--KWNEPYFDLTMPR 61
            ||.|..| |...:  ..|...:.|:..:......:.  .|...||....|  |.:....::.:||
Zfish     8 LWVAWLCTCSKAVRQCACPPDEQVAQRSEGKGHLRHRLMHQRASHRDRAHRRKGSRLVSEINLPR 72

  Fly    62 ------NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEW 120
                  ::...||..|.|.||.:.....|:.|:|:                              
Zfish    73 IVHHPSDVVVRVGSPATLSCRAEGNPEPTIQWLRN------------------------------ 107

  Fly   121 TLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFY--IAENRVYQ 183
                  .|..|....:.|  :||:.....:|....::......      :.:|.|  ||.|.:..
Zfish   108 ------GQPLDTDKMDAQ--SQPIVLPDGSLFFFSVVPGRKGQ------SHEAVYACIAHNSIGN 158

  Fly   184 SSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSP---EPPTHIFWYHQDKVL 245
            :::..     ..:...|:.....:...|:.|..|....:.|    ||   .|..::.| .:|.:|
Zfish   159 ATSRN-----ASLHIAALREDFRVQPSDVEVAIGEMATINC----SPPVGHPEPNVTW-RKDGIL 213

  Fly   246 SEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN----TEIASIRVHVLQG----ER 302
            ...::.        ...|.|..|:|..|....||.|||..||    .|..:.|:.||..    .:
Zfish   214 INSSNE--------HYTELKGKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVLLRK 270

  Fly   303 PEAMQTNAAPAAVALAC-----------WS--------------------CHFGQATQAVRVIST 336
            ||.:......:| ...|           ||                    .|:..|....|...|
Zfish   271 PEDVSVQLGESA-QFFCEADGDPMPSIEWSREQGPLPNGRYLINPDHSLQIHYVTAQDMGRYSCT 334

  Fly   337 MVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREK--PLTNSLLDPKIPSTTS 396
            :...|.:..|.:.||::..||              ||:|::.::  .|..||.:..:.||.|
Zfish   335 VENKLGVSVASAQLLVEDAGG--------------TRLRDLHKELSALRVSLENVTVMSTAS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 12/79 (15%)
IG_like 210..297 CDD:214653 24/93 (26%)
IGc2 217..287 CDD:197706 18/72 (25%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 22/147 (15%)
I-set 71..168 CDD:254352 22/145 (15%)
I-set 175..261 CDD:254352 24/98 (24%)
Ig2_Robo 177..261 CDD:143201 24/96 (25%)
I-set 265..350 CDD:254352 13/85 (15%)
Ig 282..350 CDD:299845 11/68 (16%)
FN3 373..448 CDD:214495 3/10 (30%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.