Sequence 1: | NP_729591.1 | Gene: | dpr10 / 39180 | FlyBaseID: | FBgn0052057 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122166.1 | Gene: | lrit3a / 558559 | ZFINID: | ZDB-GENE-080723-63 | Length: | 636 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 41/206 - (19%) |
---|---|---|---|
Similarity: | 67/206 - (32%) | Gaps: | 56/206 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 IQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIK 260
Fly 261 SEETK-----SILLIYDADLLHSGKYSCYPSNT-----EIASIRVHVLQ----------GERPEA 305
Fly 306 MQTNA-APAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGG----S 365
Fly 366 PAGGMPTRVRE 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr10 | NP_729591.1 | Ig | 63..143 | CDD:299845 | |
IG_like | 210..297 | CDD:214653 | 20/96 (21%) | ||
IGc2 | 217..287 | CDD:197706 | 17/74 (23%) | ||
lrit3a | NP_001122166.1 | LRR_8 | 81..141 | CDD:290566 | |
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR_4 | 107..145 | CDD:289563 | |||
leucine-rich repeat | 107..130 | CDD:275378 | |||
LRR_8 | 129..>171 | CDD:290566 | |||
LRR_4 | 129..170 | CDD:289563 | |||
leucine-rich repeat | 131..154 | CDD:275378 | |||
leucine-rich repeat | 155..168 | CDD:275378 | |||
TPKR_C2 | 199..249 | CDD:301599 | |||
Ig | 252..343 | CDD:299845 | 21/106 (20%) | ||
IG_like | 261..343 | CDD:214653 | 19/97 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |