DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and igsf9b

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:395 Identity:82/395 - (20%)
Similarity:128/395 - (32%) Gaps:138/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VGKSAYLGCRVK--------------HLGNKTVAWIR--HRDLHILTVGTYTYTTDQRF--QTSY 113
            ||..|.|||.:.              |:    |.|:|  :....::..|:||......:  :.|.
Zfish    34 VGGFAELGCSLTPPSEGATTPNLFPLHV----VEWVRLGYNVPILIKFGSYTPRVHPNYKGRVSL 94

  Fly   114 HRD----IDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAF 174
            .|.    :::.||:       |.|.:||:|.               |:| .|||           
Zfish    95 SRGASLMVEKLTLE-------DEGWFECRIL---------------LLD-RTSD----------- 125

  Fly   175 YIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFW- 238
                  .:|:....|..:..|...:..|.      |.|.|..|.::.|.|....:|:|.  |.| 
Zfish   126 ------EFQNGTWNFLSITAPPVFIKTPP------PFLEVLLGESLTLHCDAHGNPKPT--IIWR 176

  Fly   239 --------YHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRV 295
                    ..:.:||:|..|..::..:|                   :|.|.|:.||:|......
Zfish   177 KYLSAAEKQEEIQVLNETLSLSKVTRET-------------------AGIYKCHVSNSEGNLTHS 222

  Fly   296 HVLQGERPEAM-------------------QTNAAPAAVALACWSCHFGQATQAVRVISTMVAAL 341
            ..||.:.|..:                   |..|.|:.:....|.  .||....:.::.:.|..|
Zfish   223 TQLQVKGPPIIIIAPEDTTMNMSQDAVLQCQAEAYPSNLTYEWWK--QGQNVYHIEILKSRVKIL 285

  Fly   342 V---LLEACSSLLLQSGGGGGC-PGGG---SPAGGM------PTRVREIREKPLTNSLLDPKIPS 393
            |   ||  .|:|:....|...| |..|   .||...      |.||..:..:......:..|||.
Zfish   286 VDGTLL--ISALIPDDSGNYTCRPTNGLMTPPAASAYLTVKHPARVVRMPRETYLPMGMGGKIPC 348

  Fly   394 TTSAE 398
            ...||
Zfish   349 PVQAE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/97 (23%)
IG_like 210..297 CDD:214653 21/95 (22%)
IGc2 217..287 CDD:197706 15/78 (19%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845 28/141 (20%)
IG_like 148..227 CDD:214653 22/105 (21%)
IGc2 156..217 CDD:197706 17/81 (21%)
Ig 237..323 CDD:299845 19/89 (21%)
IG_like 237..323 CDD:214653 19/89 (21%)
Ig 345..411 CDD:143165 5/9 (56%)
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.