DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr12

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:302 Identity:96/302 - (31%)
Similarity:142/302 - (47%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NEPYFDLT--MPRNITSLVGKSAYLGCRVKHLGN-----KTVAWIRHRDLHILTVGTYTYTTDQR 108
            :.|.|:.:  |..|.|..:|.:|:|.|:|..:..     ..::|||.||.|||:.|...||.|:|
  Fly    73 DSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDER 137

  Fly   109 FQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQP-VRSYSVNLNIVDLIDAETSDIMQQYYNDD 172
            |...:....:.||||||:.|:||.|:||||:||.. :.|:.|||.:|                  
  Fly   138 FAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVV------------------ 184

  Fly   173 AFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIF 237
                                        ||.|.|||..:|:||.||||||.|||:.||.||.:::
  Fly   185 ----------------------------VPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVY 221

  Fly   238 WYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGER 302
            |...|::::...|...:..:|.....|:|.|:|.:..:..||.|:|..||||.|||.|.|.:|:.
  Fly   222 WQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDN 286

  Fly   303 PEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLL 344
            ..|:......:|..|             ..:..:|:|..:||
  Fly   287 MAAISRRKTSSADRL-------------THIFRSMLAPCLLL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 36/84 (43%)
IG_like 210..297 CDD:214653 36/86 (42%)
IGc2 217..287 CDD:197706 25/69 (36%)
dpr12NP_652462.3 IG 86..183 CDD:214652 41/96 (43%)
Ig_3 193..271 CDD:404760 28/77 (36%)
Ig strand B 204..208 CDD:409353 3/3 (100%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.