DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and opcml

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:256 Identity:53/256 - (20%)
Similarity:89/256 - (34%) Gaps:88/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DLTMPRNITSLVGKSAYLGCRVKHLGNKT--VAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID 118
            |..:..|||...|.||.|.|   .:.||.  |||:....  ||..|...::.|.|. ...:..::
Zfish    35 DSYLKDNITVRQGDSAVLKC---SMDNKVSRVAWLNRTT--ILFTGNEKWSLDPRV-VLLNTAVN 93

  Fly   119 EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQ 183
            |::::|......|.|.|.|.|.|.. :..|..::::                             
Zfish    94 EYSIKILNVNLYDEGPYVCSILTNK-KPESTKVHLI----------------------------- 128

  Fly   184 SSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEE 248
                           |.||...:....|:.|::||.::|.|:....|||  .|.|          
Zfish   129 ---------------VQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEP--SILW---------- 166

  Fly   249 TSGGRLKFKTIKSEETKSILLIYDADLLH--------SGKYSCYPSN----TEIASIRVHV 297
                  ||::.|...     ::.:.:.:.        ||.|.|..||    .::.:::|.|
Zfish   167 ------KFRSSKGNR-----IVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 25/81 (31%)
IG_like 210..297 CDD:214653 21/98 (21%)
IGc2 217..287 CDD:197706 16/77 (21%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 27/138 (20%)
IG_like 41..129 CDD:214653 27/138 (20%)
IG_like 139..216 CDD:214653 21/99 (21%)
IGc2 146..202 CDD:197706 16/78 (21%)
I-set 219..307 CDD:254352
ig 223..307 CDD:278476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.