DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and opcml

DIOPT Version :10

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:249 Identity:56/249 - (22%)
Similarity:89/249 - (35%) Gaps:74/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DLTMPRNITSLVGKSAYLGCRVKHLGNKT--VAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID 118
            |..:..|||...|.||.|.|   .:.||.  |||:....  ||..|...::.|.|. ...:..::
Zfish    35 DSYLKDNITVRQGDSAVLKC---SMDNKVSRVAWLNRTT--ILFTGNEKWSLDPRV-VLLNTAVN 93

  Fly   119 EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQ 183
            |::::|......|.|.|.|.|.|.. :..|..::::                             
Zfish    94 EYSIKILNVNLYDEGPYVCSILTNK-KPESTKVHLI----------------------------- 128

  Fly   184 SSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFW-YHQDKVLSE 247
                           |.||...:....|:.|::||.::|.|:....|||  .|.| :...|....
Zfish   129 ---------------VQVPARIVNVSTDVSVNEGSNVSLMCLAIGRPEP--SILWKFRSSKGNRI 176

  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN----TEIASIRVHV 297
            .|.|..::...|    ||.:          ||.|.|..||    .::.:::|.|
Zfish   177 VTEGEYVEMTGI----TKDM----------SGSYDCITSNDISPPDVRTVQVTV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 53..138 CDD:472250 24/83 (29%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 0/3 (0%)
Ig_3 214..287 CDD:464046 20/73 (27%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 27/138 (20%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 62..66 CDD:409353 2/3 (67%)
Ig strand E 95..99 CDD:409353 0/3 (0%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 128..214 CDD:472250 26/145 (18%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 0/3 (0%)
Ig strand F 195..200 CDD:409353 2/4 (50%)
Ig 220..308 CDD:472250
Ig strand B 236..240 CDD:409353
Ig strand C 249..253 CDD:409353
Ig strand E 275..279 CDD:409353
Ig strand F 289..294 CDD:409353
Ig strand G 302..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.