DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and negr1

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:284 Identity:65/284 - (22%)
Similarity:98/284 - (34%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTT 105
            ||..|.|...:.    .|...::.|..|.:|.|.|.:.. |....||:....  |:..|...::.
Zfish    29 PSCLPAGQTVDY----TTSSESVVSRQGDTALLRCYLLD-GISKGAWLNRSS--IIYAGNDKWSG 86

  Fly   106 DQRFQ-TSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYY 169
            |.|.. .|...|..|::|||:.....|.|||.|.|.::    .:::..::.||            
Zfish    87 DPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSE----RNLHPKLIQLI------------ 135

  Fly   170 NDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPT 234
                                         |.||........|:.|::||.::|.|.....|||  
Zfish   136 -----------------------------VKVPPKIYDISSDITVNEGSNVSLICAASGKPEP-- 169

  Fly   235 HIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIAS-----IR 294
            .|.|.|......:..||..|....|..::              :|.|.|...| :|||     :|
Zfish   170 KISWRHISPSARKYESGEYLNITGISRDQ--------------AGDYECGAEN-DIASPDTKTVR 219

  Fly   295 VHVLQGERPEAMQTNAA-PAAVAL 317
            |.|........|:::.. |..|||
Zfish   220 VTVNFPPAIHEMKSHGVRPGQVAL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/80 (30%)
IG_like 210..297 CDD:214653 25/91 (27%)
IGc2 217..287 CDD:197706 17/69 (25%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 24/81 (30%)
IG_like 44..136 CDD:214653 26/139 (19%)
I-set 140..222 CDD:254352 25/98 (26%)
IGc2 153..208 CDD:197706 17/70 (24%)
IG_like 236..312 CDD:214653 4/8 (50%)
IGc2 238..304 CDD:197706 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.