DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:285 Identity:64/285 - (22%)
Similarity:106/285 - (37%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWTALFCCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVG 68
            |.:.||..|.....|....:.:.::.::::..|               :|.| :....|:|...|
  Fly     5 LQSTLFVILIMATKCGSGSTQNQHHESSSQLDP---------------DPEF-IGFINNVTYPAG 53

  Fly    69 KSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAG 133
            :.|.|.|.|::||...|.|:|..|..:|.:.....|.:.|... .|:|:..|.|:|...::.|.|
  Fly    54 REAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISV-MHQDMHTWKLKISKLRESDRG 117

  Fly   134 VYECQISTQPVRSYSVNLNIVDLIDAET-SDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQ 197
            .|.|||:|.|::..      |..||.:. .||:                    |:|         
  Fly   118 CYMCQINTSPMKKQ------VGCIDVQVPPDII--------------------NEE--------- 147

  Fly   198 TVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSE 262
                      ...||.|.:|....|||....:|:|  .:.|..:|..:......|..:...::|.
  Fly   148 ----------SSADLAVQEGEDATLTCKATGNPQP--RVTWRREDGEMILIRKPGSRELMKVESY 200

  Fly   263 ETKSILLIYDADLLHSGKYSCYPSN 287
            ...|:.|: ..:....|.|.|..||
  Fly   201 NGSSLRLL-RLERRQMGAYLCIASN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 27/79 (34%)
IG_like 210..297 CDD:214653 20/78 (26%)
IGc2 217..287 CDD:197706 15/69 (22%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 32/98 (33%)
Ig 47..129 CDD:299845 29/82 (35%)
Ig 140..238 CDD:299845 24/127 (19%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.