DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and klg

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:330 Identity:76/330 - (23%)
Similarity:106/330 - (32%) Gaps:128/330 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLAVCYQRQSVSNNNHNN-----------AEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLV 67
            |.||   ..::||...|:           |.:..|...|.....||.:.             ::|
  Fly    66 GFAV---EAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYR-------------AVV 114

  Fly    68 GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDA 132
            |.:..|.|:|::|||..:.|  .|..::||......|.|:|.     |.||.:.|:|...:.:||
  Fly   115 GDTLVLPCQVENLGNFVLLW--RRGTNVLTASNIMVTRDERV-----RLIDGYNLEISDLEPQDA 172

  Fly   133 GVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQ 197
            |.|.||||.:                          .|.|..:..|..|             |..
  Fly   173 GDYVCQISDK--------------------------INRDQVHTVEILV-------------PPS 198

  Fly   198 TVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSE 262
            ..|:||:     ..|...||..|.|.|  |.|..|...|:|                   |.||.
  Fly   199 VRAIPTS-----GQLQARKGGPITLEC--KGSGNPVPSIYW-------------------TKKSG 237

  Fly   263 ETKSILLIYDADLL--------HSGKYSC-------------------YPSNTEIASIRVHVLQG 300
            ..||...|.|..:|        .:|.|.|                   ||.:.::....:|  .|
  Fly   238 ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIH--SG 300

  Fly   301 ERPEA 305
            |..||
  Fly   301 EGFEA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 28/79 (35%)
IG_like 210..297 CDD:214653 24/113 (21%)
IGc2 217..287 CDD:197706 22/96 (23%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 15/73 (21%)
IG_like 109..195 CDD:214653 31/131 (24%)
Ig 118..191 CDD:143165 28/105 (27%)
IG_like 205..274 CDD:214653 22/94 (23%)
IGc2 213..273 CDD:197706 20/80 (25%)
IGc2 301..367 CDD:197706 3/5 (60%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.