DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Dscam3

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:309 Identity:65/309 - (21%)
Similarity:100/309 - (32%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVK 78
            ||..|     |::|:..:.:         |....:.:..||.....|  |.::.|:...:.|   
  Fly   515 GLYKC-----VASNSMGSVQ---------HSARLNVYGPPYVRAIGP--IKAVAGEDIIVHC--- 560

  Fly    79 HLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI----DEWTLQIKWAQQ-RDAGVYECQ 138
            ......|..||....|            |...||.|.::    |...|.||..:. ||.|:|.|.
  Fly   561 PFAGYPVEQIRWEKAH------------QELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCI 613

  Fly   139 IST----QPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTV 199
            :.:    :..|...:|:|...:|              :.|...:|                    
  Fly   614 VRSRAGEEARRDMQLNVNSPPVI--------------EPFKFPKN-------------------- 644

  Fly   200 AVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEET 264
                          :.:|....:||.:. |.:.|.:..|...|..:.....      .|.|.||.
  Fly   645 --------------LQEGGRAQITCAVS-SGDMPIYFSWKKDDSSIPSSLQ------ITEKKEEF 688

  Fly   265 KSILLIYDADLLHSGKYSCYPSNTE-----IASIRVHVLQGERPEAMQT 308
            .|:|:..|....|||||:||.||..     .|.::|.|....|.|.|.|
  Fly   689 YSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDT 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 20/88 (23%)
IG_like 210..297 CDD:214653 25/91 (27%)
IGc2 217..287 CDD:197706 21/69 (30%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 6/31 (19%)
IGc2 553..619 CDD:197706 19/80 (24%)
I-set 634..724 CDD:254352 27/144 (19%)
ig 645..712 CDD:278476 22/73 (30%)
IG_like 734..815 CDD:214653 2/4 (50%)
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.