DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr5

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:312 Identity:102/312 - (32%)
Similarity:155/312 - (49%) Gaps:59/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTLWTALFCCLTGLAVCYQRQSVSNN---NHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRN 62
            ||..:......:.||.....:||..::   .|..|..:.::..|.:|..    .:|.||.|..|.
  Fly    39 MLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDA----IDPVFDNTTDRE 99

  Fly    63 ITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWA 127
            :.:.:|.:|.|.|||:|||::.|:|||.|||||||:|..|||.||||...:..:.|||.|:|...
  Fly   100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164

  Fly   128 QQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGM 192
            |||||||||||:||:|..|.:..|.:|      ||                              
  Fly   165 QQRDAGVYECQVSTEPKISLAYKLVVV------TS------------------------------ 193

  Fly   193 FGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFK 257
                      .|.||...:|::..||.||||||...:|.|.||:.| |:|..|..:::.|.::.:
  Fly   194 ----------KAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLW-HKDTELVSDSARGGIRVE 247

  Fly   258 TIKSEETKSILL--IYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ 307
            :.:..:|.::::  :...|   ||.|:|...|:...|:.||:::.|:..|||
  Fly   248 SEQQMKTSNLVISRVQHTD---SGNYTCSADNSNSDSVFVHIIKSEQHAAMQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 46/79 (58%)
IG_like 210..297 CDD:214653 27/88 (31%)
IGc2 217..287 CDD:197706 23/71 (32%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 51/95 (54%)
IG_like 98..179 CDD:214653 46/80 (58%)
IG_like 206..278 CDD:214653 24/75 (32%)
Ig 211..278 CDD:143165 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444678
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.