DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Ama

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:269 Identity:59/269 - (21%)
Similarity:98/269 - (36%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIR---HRDLH--ILTVGTYTYTTDQRFQTSYHRDIDE- 119
            :::.:.||.|....|.|:.:|..:|:|.:   ..|.:  :|::.......|||    |:..:.| 
  Fly    40 KDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQR----YNVTVTEG 100

  Fly   120 -------WTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIA 177
                   :|.:|:..:..|.|.||||:........:..|:    :..:|..:           ||
  Fly   101 PKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLS----LQIKTPPV-----------IA 150

  Fly   178 ENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD 242
            ||                     .|.:|:       |.:|..:.|||.....|:|.  |.|..:.
  Fly   151 EN---------------------TPKSTL-------VTEGQNLELTCHANGFPKPT--ISWAREH 185

  Fly   243 KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTE----IASIRVHV-----L 298
            ..:.  .:||.|     .:|.|..|..::..|   .|.|.|...|.|    ...|||.|     :
  Fly   186 NAVM--PAGGHL-----LAEPTLRIRSVHRMD---RGGYYCIAQNGEGQPDKRLIRVEVEFRPQI 240

  Fly   299 QGERPEAMQ 307
            ..:||:..|
  Fly   241 AVQRPKIAQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/92 (25%)
IG_like 210..297 CDD:214653 24/90 (27%)
IGc2 217..287 CDD:197706 18/69 (26%)
AmaNP_731114.2 I-set 33..143 CDD:254352 24/110 (22%)
Ig 37..127 CDD:299845 22/90 (24%)
IG_like 154..234 CDD:214653 26/98 (27%)
IGc2 161..223 CDD:197706 19/73 (26%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.