DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr11

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:273 Identity:98/273 - (35%)
Similarity:132/273 - (48%) Gaps:53/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRD 116
            |||.|.....|:|:.:|..|||.||||.||||:|:|||.||.|||||....:..||||......|
  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180

  Fly   117 IDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRV 181
             ..||||||:.|.||||.||||:||:|..|..|.|.:|                           
  Fly   181 -KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVV--------------------------- 217

  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLS 246
                               ||...|||.||.||..||.:.|.||::.:.||||.|.|||..:.|:
  Fly   218 -------------------VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLA 263

  Fly   247 EETSGGR------LKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEA 305
            .::...|      |...:.:.:.|...|:|..|....:|.|:|.|||:..|::.::::.||...:
  Fly   264 ADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSAS 328

  Fly   306 MQTNAAPAAVALA 318
            ..|::|....|.|
  Fly   329 AVTSSAATTRAYA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 46/79 (58%)
IG_like 210..297 CDD:214653 31/92 (34%)
IGc2 217..287 CDD:197706 24/75 (32%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 51/91 (56%)
Ig 127..217 CDD:299845 50/90 (56%)
IG_like 227..320 CDD:214653 31/92 (34%)
IGc2 234..311 CDD:197706 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444668
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.