DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and LSAMP

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:234 Identity:58/234 - (24%)
Similarity:86/234 - (36%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKW 126
            |||...|.:|.|.|.|:...:| |||:....  |:..|...::.|.|.:......: |::|:|:.
Human    40 NITVRQGDTAILRCVVEDKNSK-VAWLNRSG--IIFAGHDKWSLDPRVELEKRHSL-EYSLRIQK 100

  Fly   127 AQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAG 191
            ....|.|.|.|.:.||.              :.:||.:          |:               
Human   101 VDVYDEGSYTCSVQTQH--------------EPKTSQV----------YL--------------- 126

  Fly   192 MFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKF 256
                  .|.||........|:.|::||.:.|.|:....|||.  |.|.|.       |..||   
Human   127 ------IVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPV--ITWRHL-------TPTGR--- 173

  Fly   257 KTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRV 295
               :.|..:..|.|.......||||.|..:| |::|..|
Human   174 ---EFEGEEEYLEILGITREQSGKYECKAAN-EVSSADV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/79 (29%)
IG_like 210..297 CDD:214653 27/86 (31%)
IGc2 217..287 CDD:197706 21/69 (30%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 28/136 (21%)
Ig 132..215 CDD:386229 27/93 (29%)
Ig_3 219..294 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.