DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr13

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:349 Identity:97/349 - (27%)
Similarity:155/349 - (44%) Gaps:93/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QRQSVSNNNHNNAEAKPTHAP---PSHYPHGHKWNEP-----------------------YFDLT 58
            |...:..::|:..:||.|..|   |.|.|      ||                       ||...
  Fly   122 QEAVLQTHSHSRIQAKDTAGPYPIPVHRP------EPVENHLEANNGIEGGMESLFGTPMYFGTE 180

  Fly    59 MPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQ 123
            ....:|:.:|.:|::.|.|.|:|...|:|||.:|.|:||||..||::|:||..::.:..::||||
  Fly   181 NSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQ 245

  Fly   124 IKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDE 188
            ||:.|.|||||||||:||.|..|..::|::|:                                 
  Fly   246 IKFVQLRDAGVYECQVSTHPPTSIFLHLSVVE--------------------------------- 277

  Fly   189 FAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGR 253
                         ..|.|.|.|..|:..|||:.|.|.:..:.|...:|||||.:::::.:...| 
  Fly   278 -------------ARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRG- 328

  Fly   254 LKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALA 318
            :...| :.:...|.|.|......|||.::|..|||:.||:.||:.:|:.|.||            
  Fly   329 INVST-EPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAM------------ 380

  Fly   319 CWSCHFGQATQAVRVISTMVAALV 342
             :..|.|.:|:..:....|:..::
  Fly   381 -YHGHVGGSTKTTQSQLHMIMIII 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 40/79 (51%)
IG_like 210..297 CDD:214653 28/86 (33%)
IGc2 217..287 CDD:197706 20/69 (29%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 43/95 (45%)
IG_like 182..262 CDD:214653 38/79 (48%)
IG_like 285..362 CDD:214653 23/78 (29%)
IGc2 292..361 CDD:197706 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.