DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Dscam2

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:437 Identity:86/437 - (19%)
Similarity:140/437 - (32%) Gaps:132/437 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLAVCYQRQSVSNNNHNNAEAKPTHAPP-SHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRV 77
            |:..|..|:...:.....||.:...||| ..|....:..:|              |.:..|.|..
  Fly   396 GMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQP--------------GPAVSLKCSA 446

  Fly    78 KHLGNKT--VAWIRHRDLHILTVGTYTYTTDQRFQ----TSYHRDIDEWTLQIKWAQQRDAGVYE 136
              .||.|  ::|         |:..:...::.||.    .:.|.|:.. .:.|......|.|.|.
  Fly   447 --AGNPTPQISW---------TLDGFPLPSNGRFMIGQYITVHGDVIS-HVNISHVMVEDGGEYA 499

  Fly   137 CQISTQPVR-SYSVNLNI-----------VDLIDAET-------------------------SDI 164
            |....:..| .::..|||           |..:..||                         .||
  Fly   500 CIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDI 564

  Fly   165 MQQYYNDDAFYI------AENRVY----QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGST 219
            .|:...|.:..|      :::.||    ::.....|...|.:..:..|..:......|.::.|..
  Fly   565 RQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDR 629

  Fly   220 INLTC-IIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSC 283
            .:||| ::|  .:.|..|.|....:.: :.|....:|    :.::..|||:|.:....|:|.|||
  Fly   630 ASLTCSVVK--GDLPLTINWRKDGRPI-DPTQHMSVK----QVDQYNSILVIENLGSDHTGNYSC 687

  Fly   284 YPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACS 348
            .        :|....:.|..:|:..|..|                   |.|...|.|.|  |...
  Fly   688 V--------VRNSAAEVENSQALLVNVPP-------------------RWIVEPVDANV--ERNR 723

  Fly   349 SLLLQSGGGGGCPGGGSP---------AGGMPTRVREIREKPLTNSL 386
            .::|.      |...|.|         .|.......|:||:|.|..|
  Fly   724 HIMLH------CQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLL 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 17/85 (20%)
IG_like 210..297 CDD:214653 21/87 (24%)
IGc2 217..287 CDD:197706 19/70 (27%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 5/21 (24%)
IGc2 344..407 CDD:197706 3/10 (30%)
IG_like 432..517 CDD:214653 20/110 (18%)
IGc2 436..507 CDD:197706 18/96 (19%)
I-set 521..610 CDD:254352 12/88 (14%)
IGc2 533..597 CDD:197706 9/63 (14%)
Ig 630..699 CDD:143165 20/83 (24%)
IG_like 714..802 CDD:214653 15/59 (25%)
Ig 725..802 CDD:299845 11/46 (24%)
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.