DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr20

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:310 Identity:81/310 - (26%)
Similarity:134/310 - (43%) Gaps:84/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NNNHNNAEAKPTHAP------------PSHYPHGHKWNEPYFD----LTMPRNITSLVGKSAYLG 74
            ::.|..::.:.|.||            ..|:.|..::. |:|:    :....|:|...|.|.:|.
  Fly   227 DSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLN 290

  Fly    75 CRVKHLGNKTVAWIRHRD----------LHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQ 129
            ||:..|.:|||:|:||..          |.:||||.:|||.|:|::..:... :.|.|:|...::
  Fly   291 CRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP-NNWRLKITNVKK 354

  Fly   130 RDAGVYECQISTQPVRSYSVNLNI----VDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFA 190
            .|..:|||||||.|.|...:||::    |.::|.....:.::||..|                  
  Fly   355 DDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEID------------------ 401

  Fly   191 GMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLK 255
                                       ||:.|:|:::......:.:||.|.|.:|:.:.:.|.:.
  Fly   402 ---------------------------STLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVS 439

  Fly   256 FKTIKSEE----TKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGE 301
            .||...|:    |.||..|...|   ||.|:|..|..:..:|.||:|.||
  Fly   440 VKTELMEDGANSTLSIAKISKTD---SGNYTCSISEFQNFTIVVHILNGE 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 34/89 (38%)
IG_like 210..297 CDD:214653 25/90 (28%)
IGc2 217..287 CDD:197706 22/73 (30%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 32/87 (37%)
Ig 279..378 CDD:299845 38/99 (38%)
Ig 400..471 CDD:299845 23/118 (19%)
IG_like 402..480 CDD:214653 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444670
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.