DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and wrapper

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:50/111 - (45%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTS 112
            |....|...:..|...|.| |..|:|.|.|:.....||.|. |..|.: .:|.::.|.:...|| 
  Fly   217 HVLFSPEVSIPQPVVYTKL-GSRAHLECIVEAAPAATVKWF-HHGLPV-ALGAHSTTHESELQT- 277

  Fly   113 YHRDIDEWT------LQIKWAQQRDAGVYECQISTQ-PVRSYSVNL 151
             :|.:|.:.      |.:|..:..|.|.|||:.|.| .|:|.||.|
  Fly   278 -NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVEL 322

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 27/86 (31%)
IG_like 210..297 CDD:214653
IGc2 217..287 CDD:197706
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653