DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr19

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:313 Identity:82/313 - (26%)
Similarity:127/313 - (40%) Gaps:112/313 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNITSLV---GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL 122
            :|.|.::   |..|.|.|.||.....||:|||.:|..:||||..|:::|:||...:.|.:..|:|
  Fly    45 KNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSL 109

  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187
            :||..::.|.|.||||:|..|.:|..:.|.||:.:                              
  Fly   110 RIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAV------------------------------ 144

  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252
                            |.|...|:|::|:.||:.|.|.:|.:.|.|..:||||..|:::.::.||
  Fly   145 ----------------AEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGG 193

  Fly   253 RL------------KF----------KTIKSEETK------------------------------ 265
            .:            :|          .|:..|.:.                              
  Fly   194 FVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQ 258

  Fly   266 -----------SILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ 307
                       |:|.:...:..|:|.|:|.|||...|||.||||:||:..|||
  Fly   259 HQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 33/82 (40%)
IG_like 210..297 CDD:214653 33/149 (22%)
IGc2 217..287 CDD:197706 24/132 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 31/76 (41%)
IGc2 55..125 CDD:197706 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.