DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and Obscn

DIOPT Version :9

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038943147.1 Gene:Obscn / 338458 RGDID:631335 Length:9211 Species:Rattus norvegicus


Alignment Length:368 Identity:69/368 - (18%)
Similarity:121/368 - (32%) Gaps:112/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DLTMPR-----------NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRF 109
            |:|.|:           .:.:..|.||.|.|.|.. ....|:|               :...::.
  Rat  1892 DVTEPKVVFAKEQQARSEVKAEAGASATLSCEVAQ-AQTEVSW---------------FKDGKKL 1940

  Fly   110 QTSYHRDID----EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170
            .:|....::    ...|.::.|.:.|||.|.|:...|.|   |..|:                  
  Rat  1941 SSSSKVRVEASGCSRRLVVQQAGKADAGEYSCEAGGQKV---SFRLD------------------ 1984

  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235
                 :||.:|..:...:...                   ::..:.|::..|:|.:   .:..|.
  Rat  1985 -----VAEPKVVFAKEQQACS-------------------EVKAEAGASATLSCEV---AQAQTE 2022

  Fly   236 IFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHV--- 297
            :.|:...|.||   |..:::   :::......|::.......:|:|||.....:: |.|:.|   
  Rat  2023 VIWFKDGKKLS---SSSKVR---VEASGCSRRLVVQQVGKADAGEYSCEAGGQKV-SFRLDVPDT 2080

  Fly   298 -LQGERPEAMQTNAAPAAVALACWSCHFGQATQAV------RVISTMVAALVLLEACSSLLL--Q 353
             |...:.:...:.....|.|.|..||...||...|      :.:|:.....|....||..|:  |
  Rat  2081 KLMFAKEQQACSEVKAEAGASATLSCEVAQAQTEVTWFKDGKKLSSSSKVRVEASGCSRRLVVQQ 2145

  Fly   354 SG----GGGGCPGGG----------SPAGGMPTRVREIREKPL 382
            :|    |...|..||          .|.....|..|..|.:||
  Rat  2146 AGKADAGEYSCEAGGQKVSFRLDVAEPEPESQTPQRPSRREPL 2188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 16/83 (19%)
IG_like 210..297 CDD:214653 16/86 (19%)
IGc2 217..287 CDD:197706 14/69 (20%)
ObscnXP_038943147.1 Ig strand C' 2122..2125 CDD:409353 0/2 (0%)
Ig strand D 2130..2135 CDD:409353 1/4 (25%)
Ig strand E 2138..2143 CDD:409353 2/4 (50%)
Ig strand F 2152..2158 CDD:409353 2/5 (40%)
Ig strand G 2161..2169 CDD:409353 0/7 (0%)
Ig 2187..2253 CDD:416386 2/2 (100%)
Ig strand B 2196..2200 CDD:409353
Ig strand C 2209..2213 CDD:409353
Ig strand E 2234..2238 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2273..2353 CDD:416386
Ig strand A 2273..2275 CDD:409353
Ig strand A' 2278..2281 CDD:409353
Ig strand B 2285..2291 CDD:409353
Ig strand C 2298..2303 CDD:409353
Ig strand C' 2306..2309 CDD:409353
Ig strand D 2314..2319 CDD:409353
Ig strand E 2322..2327 CDD:409353
Ig strand F 2336..2342 CDD:409353
Ig strand G 2345..2353 CDD:409353
Ig 2360..2443 CDD:416386
Ig strand A' 2367..2371 CDD:409353
Ig strand B 2375..2381 CDD:409353
Ig strand C 2388..2393 CDD:409353
Ig strand C' 2396..2399 CDD:409353
I-set 9..98 CDD:400151
Ig strand A 9..13 CDD:409353
Ig strand A' 16..21 CDD:409353
Ig strand B 25..33 CDD:409353
Ig strand C 39..44 CDD:409353
Ig strand C' 47..49 CDD:409353
Ig strand D 55..58 CDD:409353
Ig strand E 61..67 CDD:409353
Ig strand F 77..85 CDD:409353
I-set 109..200 CDD:400151
Ig strand A' 115..120 CDD:409353
Ig strand B 126..133 CDD:409353
Ig strand C 139..144 CDD:409353
Ig strand C' 146..148 CDD:409353
Ig strand D 156..159 CDD:409353
Ig strand E 166..172 CDD:409353
Ig strand F 179..186 CDD:409353
I-set 246..326 CDD:400151
Ig strand B 252..259 CDD:409353
Ig strand C 266..272 CDD:409353
Ig strand C' 273..276 CDD:409353
Ig strand D 282..288 CDD:409353
Ig strand E 291..301 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 315..326 CDD:409353
Ig 333..416 CDD:416386
Ig strand A' 335..341 CDD:409353
Ig strand B 348..355 CDD:409353
Ig strand C 360..365 CDD:409353
Ig strand D 375..379 CDD:409353
Ig strand E 384..391 CDD:409353
Ig strand F 398..405 CDD:409353
Ig strand A 422..424 CDD:409353
Ig 423..492 CDD:416386
Ig strand A' 427..431 CDD:409353
Ig strand B 435..441 CDD:409353
Ig strand C 448..453 CDD:409353
Ig strand C' 456..459 CDD:409353
Ig strand D 464..469 CDD:409353
Ig strand E 472..477 CDD:409353
Ig strand F 486..492 CDD:409353
Ig strand G 495..503 CDD:409353
FN3 513..600 CDD:238020
Ig 615..>671 CDD:416386
Ig 710..789 CDD:416386
Ig strand A' 713..717 CDD:409353
Ig strand B 721..727 CDD:409353
Ig strand C 734..739 CDD:409353
Ig strand C' 742..745 CDD:409353
Ig strand D 750..755 CDD:409353
Ig strand E 758..763 CDD:409353
Ig strand F 772..778 CDD:409353
Ig strand G 781..789 CDD:409353
Ig 800..881 CDD:416386
Ig strand A 800..802 CDD:409353
Ig strand A' 805..809 CDD:409353
Ig strand B 813..819 CDD:409353
Ig strand C 826..831 CDD:409353
Ig strand C' 834..837 CDD:409353
Ig strand D 842..847 CDD:409353
Ig strand E 850..855 CDD:409353
Ig strand F 864..870 CDD:409353
Ig strand G 873..881 CDD:409353
Ig 892..973 CDD:416386
Ig strand A 892..894 CDD:409353
Ig strand A' 897..901 CDD:409353
Ig strand B 905..911 CDD:409353
Ig strand C 918..923 CDD:409353
Ig strand C' 926..929 CDD:409353
Ig strand D 934..939 CDD:409353
Ig strand E 942..947 CDD:409353
Ig strand F 956..962 CDD:409353
Ig strand G 965..973 CDD:409353
Ig 984..1065 CDD:416386
Ig strand A 984..986 CDD:409353
Ig strand A' 989..993 CDD:409353
Ig strand B 997..1003 CDD:409353
Ig strand C 1010..1015 CDD:409353
Ig strand C' 1018..1021 CDD:409353
Ig strand D 1026..1031 CDD:409353
Ig strand E 1034..1039 CDD:409353
Ig strand F 1048..1054 CDD:409353
Ig strand G 1057..1065 CDD:409353
Ig 1076..1157 CDD:416386
Ig strand A 1076..1078 CDD:409353
Ig strand A' 1081..1085 CDD:409353
Ig strand B 1089..1095 CDD:409353
Ig strand C 1102..1107 CDD:409353
Ig strand C' 1110..1113 CDD:409353
Ig strand D 1118..1123 CDD:409353
Ig strand E 1126..1131 CDD:409353
Ig strand F 1140..1146 CDD:409353
Ig strand G 1149..1157 CDD:409353
Ig 1168..1249 CDD:416386
Ig strand A 1168..1170 CDD:409353
Ig strand A' 1173..1177 CDD:409353
Ig strand B 1181..1187 CDD:409353
Ig strand C 1194..1199 CDD:409353
Ig strand C' 1202..1205 CDD:409353
Ig strand D 1210..1215 CDD:409353
Ig strand E 1218..1223 CDD:409353
Ig strand F 1232..1238 CDD:409353
Ig strand G 1241..1249 CDD:409353
Ig 1260..1341 CDD:416386
Ig strand A 1260..1262 CDD:409353
Ig strand A' 1265..1269 CDD:409353
Ig strand B 1273..1279 CDD:409353
Ig strand C 1286..1291 CDD:409353
Ig strand C' 1294..1297 CDD:409353
Ig strand D 1302..1307 CDD:409353
Ig strand E 1310..1315 CDD:409353
Ig strand F 1324..1330 CDD:409353
Ig strand G 1333..1341 CDD:409353
Ig 1352..1433 CDD:416386
Ig strand A 1352..1354 CDD:409353
Ig strand A' 1357..1361 CDD:409353
Ig strand B 1365..1371 CDD:409353
Ig strand C 1378..1383 CDD:409353
Ig strand C' 1386..1389 CDD:409353
Ig strand D 1394..1399 CDD:409353
Ig strand E 1402..1407 CDD:409353
Ig strand F 1416..1422 CDD:409353
Ig strand G 1425..1433 CDD:409353
Ig 1444..1525 CDD:416386
Ig strand A 1444..1446 CDD:409353
Ig strand A' 1449..1453 CDD:409353
Ig strand B 1457..1463 CDD:409353
Ig strand C 1470..1475 CDD:409353
Ig strand C' 1478..1481 CDD:409353
Ig strand D 1486..1491 CDD:409353
Ig strand E 1494..1499 CDD:409353
Ig strand F 1508..1514 CDD:409353
Ig strand G 1517..1525 CDD:409353
Ig 1536..1617 CDD:416386
Ig strand A 1536..1538 CDD:409353
Ig strand A' 1541..1545 CDD:409353
Ig strand B 1549..1555 CDD:409353
Ig strand C 1562..1567 CDD:409353
Ig strand C' 1570..1573 CDD:409353
Ig strand D 1578..1583 CDD:409353
Ig strand E 1586..1591 CDD:409353
Ig strand F 1600..1606 CDD:409353
Ig strand G 1609..1617 CDD:409353
Ig 1628..1709 CDD:416386
Ig strand A 1628..1630 CDD:409353
Ig strand A' 1633..1637 CDD:409353
Ig strand B 1641..1647 CDD:409353
Ig strand C 1654..1659 CDD:409353
Ig strand C' 1662..1665 CDD:409353
Ig strand D 1670..1675 CDD:409353
Ig strand E 1678..1683 CDD:409353
Ig strand F 1692..1698 CDD:409353
Ig strand G 1701..1709 CDD:409353
Ig 1720..1801 CDD:416386
Ig strand A 1720..1722 CDD:409353
Ig strand A' 1725..1729 CDD:409353
Ig strand B 1733..1739 CDD:409353
Ig strand C 1746..1751 CDD:409353
Ig strand C' 1754..1757 CDD:409353
Ig strand D 1762..1767 CDD:409353
Ig strand E 1770..1775 CDD:409353
Ig strand F 1784..1790 CDD:409353
Ig strand G 1793..1801 CDD:409353